PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG122000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 246aa    MW: 26541 Da    PI: 9.1367
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG122000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB154.42e-4843136295
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdr+lP+anvsrim+++lP +akis+dake++q+cvsefisfvt+ea+++c+ e+rkt++++dl+wa+  lGf+dyv pl+++l++ r
  Pavir.4KG122000.1.p  43 REQDRLLPVANVSRIMRHALPPHAKISDDAKEMIQDCVSEFISFVTGEANERCHTEHRKTVTAEDLVWAMNRLGFDDYVRPLNAFLQRMR 132
                          89**************************************************************************************** PP

                NF-YB  92 eleg 95 
                          e+eg
  Pavir.4KG122000.1.p 133 EIEG 136
                          **98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.6E-4539144IPR009072Histone-fold
SuperFamilySSF471135.43E-3545146IPR009072Histone-fold
PfamPF008089.0E-2548112IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.3E-137694No hitNo description
PROSITE patternPS0068507995IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.3E-1395113No hitNo description
PRINTSPR006151.3E-13114132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSTDPQGPKP RAPCAMPPEH AAVAKEAMVT EPLVPSTEPV MIREQDRLLP VANVSRIMRH  60
ALPPHAKISD DAKEMIQDCV SEFISFVTGE ANERCHTEHR KTVTAEDLVW AMNRLGFDDY  120
VRPLNAFLQR MREIEGGGSG RGSRRGSSLV ALQGAQTLRP AYPDAPQGYA VRPVPRPVPV  180
PASSVASRFG SRHLQLPGGQ RSMVPYYGGA AAFRAVGSHG GFYADEASSS DEAPPAARRA  240
GSRRY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-3942133293NF-YB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0609741e-102BT060974.1 Zea mays full-length cDNA clone ZM_BFb0079C17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966908.11e-106PREDICTED: nuclear transcription factor Y subunit B-10-like
TrEMBLK3Y2D41e-112K3Y2D4_SETIT; Uncharacterized protein
STRINGSi008357m1e-112(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-47nuclear factor Y, subunit B6